TMEM158 Rabbit Polyclonal Antibody

CAT#: TA339638

Rabbit Polyclonal Anti-SEC22C Antibody

Product Images

WB Suggested Anti-SEC22C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEC22C antibody: synthetic peptide directed towards the middle region of human SEC22C. Synthetic peptide located within the following region: FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: transmembrane protein 158 (gene/pseudogene)
• Database Link:
  NP_056259
  Entrez Gene 25907 Human
  UniProt ID Q8WZ71
• Background: The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking. There are two alternat
• Synonyms: BBP; p40BBP; RIS1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome