EIF3S3 (EIF3H) Rabbit Polyclonal Antibody

CAT#: TA339679

Rabbit Polyclonal Anti-EIF3H Antibody

Product Images

WB Suggested Anti-EIF3H Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF3H antibody: synthetic peptide directed towards the C terminal of human EIF3H. Synthetic peptide located within the following region: LMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: eukaryotic translation initiation factor 3 subunit H
• Database Link:
  NP_003747
  Entrez Gene 8667 Human
  UniProt ID O15372
• Background: EIF3H belongs to the peptidase M67 family. It contains 1 MPN (JAB/Mov34) domain. EIF3H binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. It associates with the p170 subunit of EIF3.
• Synonyms: eIF3-gamma; eIF3-p40; EIF3S3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 75%