ZNHIT3 Rabbit Polyclonal Antibody

CAT#: TA339683

Rabbit Polyclonal Anti-ZNHIT3 Antibody

Product Images

WB Suggested Anti-ZNHIT3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNHIT3 antibody: synthetic peptide directed towards the N terminal of human ZNHIT3. Synthetic peptide located within the following region: HKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: zinc finger HIT-type containing 3
• Database Link:
  NP_004764
  Entrez Gene 9326 Human
  UniProt ID Q15649
• Background: ZNHIT3 contains 1 HIT-type zinc finger. The exact function of ZNHIT3 remains unknown.
• Synonyms: TRIP3
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors