SMYD3 Rabbit Polyclonal Antibody

CAT#: TA339751

Rabbit Polyclonal Anti-SMYD3 Antibody

Product Images

WB Suggested Anti-SMYD3 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMYD3 antibody: synthetic peptide directed towards the C terminal of human SMYD3. Synthetic peptide located within the following region: LHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: SET and MYND domain containing 3
• Database Link:
  NP_073580
  Entrez Gene 64754 Human
  UniProt ID Q9H7B4
• Background: SMYD3 is a histone methyltransferase that plays a role in transcriptional regulation as a member of an RNA polymerase complex.SMYD3 is a histone methyltransferase that plays a role in transcriptional regulation as a member of an RNA polymerase complex. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: bA74P14.1; KMT3E; ZMYND1; ZNFN3A1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%