MGC13096 (PDCD2L) Rabbit Polyclonal Antibody

CAT#: TA339771

Rabbit Polyclonal Anti-PDCD2L Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PDCD2L"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PDCD2L antibody: synthetic peptide directed towards the N terminal of human PDCD2L. Synthetic peptide located within the following region: FACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name programmed cell death 2-like
Background Over expression of PDCD2L attenutates TNF-alpha release in Daudi cells. PDCD2L over-expression restrained proliferation of HEK293T cells. DNA/flow cytometry analysis showed that the over-expression of PDCD2L severely delays cell cycle progression at S phase. These all suggest that PDCD2L might play a role in apoptosis.
Synonyms MGC13096
Note Immunogen Sequence Homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.