MGC13096 (PDCD2L) Rabbit Polyclonal Antibody

CAT#: TA339771

Rabbit Polyclonal Anti-PDCD2L Antibody

Product Images

WB Suggested Anti-PDCD2L Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDCD2L antibody: synthetic peptide directed towards the N terminal of human PDCD2L. Synthetic peptide located within the following region: FACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: programmed cell death 2-like
• Database Link:
  NP_115722
  Entrez Gene 84306 Human
  UniProt ID Q9BRP1
• Background: Over expression of PDCD2L attenutates TNF-alpha release in Daudi cells. PDCD2L over-expression restrained proliferation of HEK293T cells. DNA/flow cytometry analysis showed that the over-expression of PDCD2L severely delays cell cycle progression at S phase. These all suggest that PDCD2L might play a role in apoptosis.
• Synonyms: MGC13096
• Note: Immunogen Sequence Homology: Human: 100%