SUHW1 (ZNF280A) Rabbit Polyclonal Antibody

CAT#: TA339785

Rabbit Polyclonal Anti-ZNF280A Antibody

Product Images

WB Suggested Anti-ZNF280A Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF280A antibody: synthetic peptide directed towards the C terminal of human ZNF280A. Synthetic peptide located within the following region: WRHSRRRVLQCSKCRLQFLTLKEEIEHKTKDHQTFKKPEQLQGFPRETKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: zinc finger protein 280A
• Database Link:
  NP_542778
  Entrez Gene 129025 Human
  UniProt ID P59817
• Background: The predicted protein ZNF280A is similar to Drosophila suppressor of hairy wing protein, a leucine zipper protein which represses the function of transcriptional enhancers of the gypsy retrotransposon. ZNF280A may function as a transcription factor.This gene was predicted both by automated computational analysis and by similarity to a Drosophila gene and to predicted genes in other species (sheep, chimp, dog, cow). The predicted protein of this gene is similar to Drosophila suppressor of hairy wing protein, a leucine zipper protein which represses the function of transcriptional enhancers of the gypsy retrotransposon.
• Synonyms: 3 OY11.1; 3'OY11.1; SUHW1; ZNF280; ZNF636
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Guinea pig: 86%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors