Rbpj Rabbit Polyclonal Antibody

CAT#: TA339863

Rabbit Polyclonal Anti-Rbpj Antibody

Product Images

Host: Rabbit; Target Name: Rbpj; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Rbpj antibody is: synthetic peptide directed towards the middle region of Mouse Rbpj. Synthetic peptide located within the following region: MGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAET
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: recombination signal binding protein for immunoglobulin kappa J region
• Database Link:
  NP_001074396
  Entrez Gene 19664 Mouse
  UniProt ID P31266
• Background: The function of this protein remains unknown.
• Synonyms: CBF-1; CBF1; csl; IGKJRB; IGKJRB1; KBF2; MGC61669; OTTHUMP00000123441; RBP-J; RBP-JK; RBPJK; RBPSUH; SUH
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Zebrafish: 92%; Guinea pig: 92%