FHIT Rabbit Polyclonal Antibody

CAT#: TA339874

Rabbit Polyclonal Anti-FHIT Antibody

Product Images

WB Suggested Anti-FHIT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FHIT antibody: synthetic peptide directed towards the middle region of human FHIT. Synthetic peptide located within the following region: VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17
• Gene Name: fragile histidine triad
• Database Link:
  NP_002003
  Entrez Gene 2272 Human
  UniProt ID P49789
• Background: This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.
• Synonyms: AP3Aase; FRA3B
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Zebrafish: 86%; Guinea pig: 86%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Pathways: Non-small cell lung cancer, Purine metabolism, Small cell lung cancer