PRR11 Rabbit Polyclonal Antibody

CAT#: TA339879

Rabbit Polyclonal Anti-PRR11 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PRR11"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PRR11 antibody: synthetic peptide directed towards the middle region of human PRR11. Synthetic peptide located within the following region: PGKSQMDLRKLLRKVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name proline rich 11
Background The function of the PRR11 protein remains unknown.
Synonyms FLJ11029
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.