REG3A Rabbit Polyclonal Antibody

CAT#: TA339881

Rabbit Polyclonal Anti-REG3A Antibody

Product Images

WB Suggested Anti-REG3A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-REG3A antibody: synthetic peptide directed towards the N terminal of human REG3A. Synthetic peptide located within the following region: GSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: regenerating family member 3 alpha
• Database Link:
  NP_002571
  Entrez Gene 5068 Human
  UniProt ID Q06141
• Background: This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. Alternate splicing results in multiple transcript variants that encode the same protein.
• Synonyms: HIP; INGAP; PAP; PAP-H; PAP1; PBCGF; REG-III; REG3
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Sheep: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein