Csnk1a1 Rabbit Polyclonal Antibody

CAT#: TA339969

Rabbit Polyclonal Anti-Csnk1a1 Antibody

Product Images

WB Suggested Anti-Csnk1a1 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Csnk1a1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Csnk1a1. Synthetic peptide located within the following region: FGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: casein kinase 1, alpha 1
• Database Link:
  NP_446067
  Entrez Gene 113927 Rat
  UniProt ID P97633
• Background: Splice variant isoforms CKI alpha and CKI alpha L both have casein kinase I activity but display differences in substrate kinetics.
• Synonyms: CK1; CKI-alpha; HLCDGP1; PRO2975
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%