Casein Kinase 1 alpha (CSNK1A1) Rabbit Polyclonal Antibody

CAT#: TA339970

Rabbit Polyclonal Anti-CSNK1A1 Antibody

Product Images

WB Suggested Anti-CSNK1A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CSNK1A1 antibody: synthetic peptide directed towards the C terminal of human CSNK1A1. Synthetic peptide located within the following region: HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: casein kinase 1 alpha 1
• Database Link:
  NP_001883
  Entrez Gene 1452 Human
  UniProt ID P48729
• Background: CSNK1A1 belongs to the protein kinase superfamily. The function of the CSNK1A1 protein is not known.
• Synonyms: CK1; CK1a; CKIa; HEL-S-77p; HLCDGP1; PRO2975
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase
• Protein Pathways: Hedgehog signaling pathway, Wnt signaling pathway