EIF2B1 Rabbit Polyclonal Antibody

CAT#: TA340021

Rabbit Polyclonal Anti-EIF2B1 Antibody

Product Images

WB Suggested Anti-EIF2B1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysateEIF2B1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF2B1 antibody: synthetic peptide directed towards the C terminal of human EIF2B1. Synthetic peptide located within the following region: ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: eukaryotic translation initiation factor 2B subunit alpha
• Database Link:
  NP_001405
  Entrez Gene 1967 Human
  UniProt ID Q14232
• Background: EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).
• Synonyms: EIF2B; EIF2BA
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Bovine: 79%; Rabbit: 79%