DBT Rabbit Polyclonal Antibody

CAT#: TA340036

Rabbit Polyclonal Anti-DBT Antibody

Product Images

Host: Rabbit; Target Name: DBT; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DBT antibody is: synthetic peptide directed towards the N-terminal region of Human DBT. Synthetic peptide located within the following region: EWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: dihydrolipoamide branched chain transacylase E2
• Database Link:
  NP_001909
  Entrez Gene 1629 Human
  UniProt ID P11182
• Background: The function of this protein remains unknown.
• Synonyms: BCATE2; BCKAD-E2; BCKADE2; BCOADC-E2; E2; E2B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Valine, leucine and isoleucine degradation