CST8 Rabbit Polyclonal Antibody

CAT#: TA340064

Rabbit Polyclonal Anti-CST8 Antibody

Product Images

WB Suggested Anti-CST8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CST8 antibody: synthetic peptide directed towards the middle region of human CST8. Synthetic peptide located within the following region: LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: cystatin 8
• Database Link:
  NP_005483
  Entrez Gene 10047 Human
  UniProt ID O60676
• Background: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to type 2 cystatins. The protein exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. Alternative splicing identified in mouse is suggested in human based on EST evidence but the full-length nature of putative variants has not been determined.
• Synonyms: CRES; CTES5
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Dog: 92%; Pig: 92%; Bovine: 90%; Rabbit: 86%

Reference Data

• Protein Families: Secreted Protein