Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-Cystatin 8 (aa 100-112) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence STNEICAIQENSK, from the internal region of the protein sequence according to NP_005483.1. |
Rabbit polyclonal anti-CST8 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CST8. |
Anti-CST8 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 90 amino acids of human cystatin 8 (cystatin-related epididymal specific) |
Rabbit Polyclonal Anti-CST8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CST8 antibody: synthetic peptide directed towards the middle region of human CST8. Synthetic peptide located within the following region: LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY |
CST8 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CST8 |
Active filters
Target Symbol
- CST8