PDIA6 Rabbit Polyclonal Antibody

CAT#: TA340075

Rabbit Polyclonal Anti-PDIA6 Antibody

Product Images

Sample Type: 2. mouse brain extracts (80ug); Primary Antibody Dilution: 2 ug/ml; Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience; Secondary Antibody Dilution: �1: 20, 000; Image Submitted by: Yuzhi Chen; University of Arkansas fo

• 

  Sample Type: Mouse Brain lysate

• 

  WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 721_B cell lysatePDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  Sample Type: NT2 cells; Red: Antibody; Blue: DAPI; Primary Dilution: 1 ug/50ul antibody; Secondary Antibody: Alexa goat anti-rabbit 594; Image Submitted by: �Yuzhi Chen, University of Arkansas for Medical Sciences �

• 

  Amount and Sample Type: 500 ug Human NT2 cell lysate; Amount of IP Antibody: 6 ug; Primary Antibody: PDIA6; Primary Antibody Dilution: 1: 500; Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody Dilution: 1: 5000; Gene Name: PDIA6; Su

Show all 5 images

Specifications

Product Data

• Applications: IHC, IP, WB
• Recommended Dilution: WB, IHC, IP
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDIA6 antibody: synthetic peptide directed towards the N terminal of human PDIA6. Synthetic peptide located within the following region: KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: protein disulfide isomerase family A member 6
• Database Link:
  NP_005733
  Entrez Gene 71853 MouseEntrez Gene 10130 Human
  UniProt ID Q15084
• Background: Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.
• Synonyms: ERP5; P5; TXNDC7
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 86%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome