PDIA6 Rabbit Polyclonal Antibody

CAT#: TA340076

Rabbit Polyclonal Anti-PDIA6 Antibody

Product Images

WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate.PDIA6 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• 

  Host: Rabbit; Target Name: PDIA6; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: PDIA6; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: PDIA6; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: PDIA6; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml; PDIA6 is strongly supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: PDIA6; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml; PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• Immunohistochemistry with Small intestine tissue

Show all 7 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDIA6 antibody: synthetic peptide directed towards the middle region of human PDIA6. Synthetic peptide located within the following region: KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: protein disulfide isomerase family A member 6
• Database Link:
  NP_005733
  Entrez Gene 10130 Human
  UniProt ID Q15084
• Background: Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.Protein disulfide isomerases (EC 5.3.4.1), such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins (Hayano and Kikuchi, 1995 [PubMed 7590364]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-39 BF979486.1 11-49 40-1858 BC001312.1 1-1819 1859-2326 AK127433.1 2215-2682 2327-2344 BM511594.1 1-18 c
• Synonyms: ERP5; P5; TXNDC7
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome