TOB (TOB1) Rabbit Polyclonal Antibody

CAT#: TA340077

Rabbit Polyclonal Anti-TOB1 Antibody

Product Images

WB Suggested Anti-TOB1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TOB1 antibody: synthetic peptide directed towards the middle region of human TOB1. Synthetic peptide located within the following region: DLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: transducer of ERBB2, 1
• Database Link:
  NP_005740
  Entrez Gene 10140 Human
  UniProt ID P50616
• Background: This gene encodes a member of the tob/btg1 family of anti-proliferative proteins that have the potential to regulate cell growth. When exogenously expressed, this protein supresses cell growth in tissue culture. The protein undergoes phophorylation by a serine/threonine kinase, 90 kDa ribosomal S6 kinase. Interactions of this protein with the v-erb-b2 erythroblastic leukemia viral oncogene homolog 2 gene product p185 interferes with growth suppression. This protein inhibits T cell proliferation and transcription of cytokines and cyclins. The protein interacts with both mothers against decapentaplegic Drosophila homolog 2 and 4 to enhance their DNA binding activity. This interaction inhibits interleukin 2 transcription in T cells.
• Synonyms: APRO5; APRO6; PIG49; TOB; TROB; TROB1
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Yeast: 100%; Pig: 93%; Bovine: 93%; Rat: 92%; Mouse: 82%

Reference Data

• Protein Families: Druggable Genome