DSCR1L1 (RCAN2) Rabbit Polyclonal Antibody

CAT#: TA340078

Rabbit Polyclonal Anti-RCAN2 Antibody

Product Images

Host: Rabbit; Target Name: RCAN2; Sample Tissue: COLO205 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RCAN2 antibody is: synthetic peptide directed towards the middle region of HUMAN RCAN2. Synthetic peptide located within the following region: VTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: regulator of calcineurin 2
• Database Link:
  NP_001238902
  Entrez Gene 10231 Human
  UniProt ID Q14206
• Background: RCAN2 inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. RCAN2 could play a role during central nervous system development.
• Synonyms: CSP2; DSCR1L1; MCIP2; RCN2; ZAKI-4; ZAKI4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Rat: 86%; Zebrafish: 86%; Guinea pig: 86%