Epac1 (RAPGEF3) Rabbit Polyclonal Antibody

CAT#: TA340092

Rabbit Polyclonal Anti-RAPGEF3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RAPGEF3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RAPGEF3 antibody: synthetic peptide directed towards the N terminal of human RAPGEF3. Synthetic peptide located within the following region: RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 99 kDa
Gene Name Rap guanine nucleotide exchange factor 3
Background The function of the protein remains unknown.
Synonyms bcm910; CAMP-GEFI; EPAC; EPAC1; HSU79275
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Pathways Leukocyte transendothelial migration, Long-term potentiation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.