Epac1 (RAPGEF3) Rabbit Polyclonal Antibody

CAT#: TA340093

Rabbit Polyclonal Anti-RAPGEF3 Antibody

Product Images

Human CFBE

• 

  WB Suggested Anti-RAPGEF3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HCT15 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAPGEF3 antibody: synthetic peptide directed towards the middle region of human RAPGEF3. Synthetic peptide located within the following region: HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 104 kDa
• Gene Name: Rap guanine nucleotide exchange factor 3
• Database Link:
  NP_001092001
  Entrez Gene 10411 Human
  UniProt ID O95398
• Background: The function of the protein remains unknown.
• Synonyms: bcm910; CAMP-GEFI; EPAC; EPAC1; HSU79275
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 92%; Rabbit: 85%

Reference Data

• Protein Pathways: Leukocyte transendothelial migration, Long-term potentiation