Lysophospholipase 1 (LYPLA1) Rabbit Polyclonal Antibody

CAT#: TA340098

Rabbit Polyclonal Anti-LYPLA1 Antibody

Product Images

WB Suggested Anti-LYPLA1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: CCRF-CEM cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LYPLA1 antibody: synthetic peptide directed towards the middle region of human LYPLA1. Synthetic peptide located within the following region: SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: lysophospholipase I
• Database Link:
  NP_006321
  Entrez Gene 10434 Human
  UniProt ID O75608
• Background: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
• Synonyms: APT-1; APT1; hAPT1; LPL-I; LPL1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 93%; Horse: 86%; Yeast: 79%

Reference Data

• Protein Pathways: Glycerophospholipid metabolism