WASF3 Rabbit Polyclonal Antibody

CAT#: TA340126

Rabbit Polyclonal Anti-WASF3 Antibody

Product Images

WB Suggested Anti-WASF3 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate

• 

  Sample Type: 1. DF-1 cells (0.5x106 cells loaded); 2. MSB-1 cells (0.5x106 cells loaded); Primary Dilution: 1: 1000; Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase; Secondary Dilution: 1: 10, 000; Image Submitted By: Yongxiu Yao; Ins

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Chicken, Human, Turkey
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the N terminal of human WASF3. Synthetic peptide located within the following region: NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: WAS protein family member 3
• Database Link:
  NP_006637
  Entrez Gene 10810 Human
  UniProt ID Q9UPY6
• Background: WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: Brush-1; SCAR3; WAVE3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Adherens junction, Fc gamma R-mediated phagocytosis