C7orf16 (PPP1R17) Rabbit Polyclonal Antibody

CAT#: TA340131

Rabbit Polyclonal Anti-C7orf16 Antibody

Product Images

WB Suggested Anti-C7orf16 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C7orf16 antibody: synthetic peptide directed towards the middle region of human C7orf16. Synthetic peptide located within the following region: IKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: protein phosphatase 1 regulatory subunit 17
• Database Link:
  NP_006649
  Entrez Gene 10842 Human
  UniProt ID O96001
• Background: The function of C7orf16 remains unknown.
• Synonyms: C7orf16; GSBS
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Rabbit: 85%

Reference Data

• Protein Pathways: Long-term depression