PIM2 Rabbit Polyclonal Antibody

CAT#: TA340146

Rabbit Polyclonal Anti-PIM2 Antibody

Product Images

WB Suggested Anti-PIM2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIM2 antibody: synthetic peptide directed towards the middle region of human PIM2. Synthetic peptide located within the following region: LRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: Pim-2 proto-oncogene, serine/threonine kinase
• Database Link:
  NP_006866
  Entrez Gene 11040 Human
  UniProt ID Q9P1W9
• Background: This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.
• Synonyms: Pim-2h
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Acute myeloid leukemia