DNAJB4 Rabbit Polyclonal Antibody

CAT#: TA340147

Rabbit Polyclonal Anti-DNAJB4 Antibody

Product Images

WB Suggested Anti-DNAJB4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: NCI-H226 cell lysate.DNAJB4 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DNAJB4 antibody: synthetic peptide directed towards the middle region of human DNAJB4. Synthetic peptide located within the following region: EGTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: DnaJ heat shock protein family (Hsp40) member B4
• Database Link:
  NP_008965
  Entrez Gene 11080 Human
  UniProt ID Q9UDY4
• Background: DNAJB4 belongs to the evolutionarily conserved DNAJ/HSP40 protein family. For background information on the DNAJ family, see MIM 608375.
• Synonyms: DjB4; DNAJW; HLJ1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%