TADA1L (TADA1) Rabbit Polyclonal Antibody

CAT#: TA340229

Rabbit Polyclonal Anti-TADA1L Antibody

Product Images

WB Suggested Anti-TADA1L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 2500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TADA1L antibody: synthetic peptide directed towards the C terminal of human TADA1L. Synthetic peptide located within the following region: REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: transcriptional adaptor 1
• Database Link:
  NP_444281
  Entrez Gene 117143 Human
  UniProt ID Q96BN2
• Background: TADA1L belongs to the TADA1L family.It is probably involved in transcriptional regulation.
• Synonyms: ADA1; hADA1; HFI1; STAF42; TADA1L
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 75%