DUSP19 Rabbit Polyclonal Antibody

CAT#: TA340253

Rabbit Polyclonal Anti-DUSP19 Antibody

Product Images

WB Suggested Anti-DUSP19 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DUSP19 antibody: synthetic peptide directed towards the C terminal of human DUSP19. Synthetic peptide located within the following region: SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: dual specificity phosphatase 19
• Database Link:
  NP_543152
  Entrez Gene 142679 Human
  UniProt ID Q8WTR2
• Background: DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.
• Synonyms: DUSP17; LMWDSP3; SKRP1; TS-DSP1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 92%; Mouse: 92%; Dog: 86%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Phosphatase