DUSP19 Rabbit Polyclonal Antibody

CAT#: TA340253

Rabbit Polyclonal Anti-DUSP19 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DUSP19"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DUSP19 antibody: synthetic peptide directed towards the C terminal of human DUSP19. Synthetic peptide located within the following region: SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 24 kDa
Gene Name dual specificity phosphatase 19
Background DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.
Synonyms DUSP17; LMWDSP3; SKRP1; TS-DSP1
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 92%; Mouse: 92%; Dog: 86%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome, Phosphatase

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.