C6orf150 (MB21D1) Rabbit Polyclonal Antibody

CAT#: TA340293

Rabbit Polyclonal Anti-MB21D1 Antibody

Product Images

WB Suggested Anti-MB21D1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: C6orf150; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Concentration:

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MB21D1 antibody: synthetic peptide directed towards the middle region of human MB21D1. Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: Mab-21 domain containing 1
• Database Link:
  NP_612450
  Entrez Gene 115004 Human
  UniProt ID Q8N884
• Background: The exact function of MB21D1 remains unknown.
• Synonyms: C6orf150; cGAS; h-cGAS
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Bovine: 86%; Guinea pig: 79%