DPPA2 Rabbit Polyclonal Antibody

CAT#: TA340320

Rabbit Polyclonal Anti-DPPA2 Antibody

Product Images

WB Suggested Anti-DPPA2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DPPA2 antibody: synthetic peptide directed towards the N terminal of human DPPA2. Synthetic peptide located within the following region: NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: developmental pluripotency associated 2
• Database Link:
  NP_620170
  Entrez Gene 151871 Human
  UniProt ID Q7Z7J5
• Background: DPPA2 may play a role in maintaining cell pluripotentiality. ECSA/DPPA2 is a promising target for antigen-specific immunotherapy in non-small cell lung cancers.
• Synonyms: CT100; ECAT15-2; PESCRG1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 90%

Reference Data

• Protein Families: Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency