HOXA3 Rabbit Polyclonal Antibody

CAT#: TA341407

Rabbit Polyclonal Anti-HOXA3 Antibody

Product Images

WB Suggested Anti-HOXA3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: HOXA3; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HOXA3 antibody: synthetic peptide directed towards the C terminal of human HOXA3. Synthetic peptide located within the following region: MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPAC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: homeobox A3
• Database Link:
  NP_109377
  Entrez Gene 15400 MouseEntrez Gene 3200 Human
  UniProt ID O43365
• Background: In vertebrates,The genes encodingThe class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression ofThese proteins is spatially and temporally regulated during embryonic development.This gene is part ofThe A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Three transcript variants encoding two different isoforms have been found forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: HOX1; HOX1E
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Transcription Factors