HOXA3 Rabbit Polyclonal Antibody

CAT#: TA341408

Rabbit Polyclonal Anti-HOXA3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "HOXA3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HOXA3 antibody: synthetic peptide directed towards the middle region of human HOXA3. Synthetic peptide located within the following region: PPQKRYTAAGAGAGGTPDYDPHAHGLQGNGSYGTPHIQGSPVFVGGSYVE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 46 kDa
Gene Name homeobox A3
Background In vertebrates,The genes encodingThe class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression ofThese proteins is spatially and temporally regulated during embryonic development.This gene is part ofThe A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Three transcript variants encoding two different isoforms have been found forThis gene. [provided by RefSeq, Jul 2008]
Synonyms HOX1; HOX1E
Note Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Rat: 92%; Rabbit: 92%; Guinea pig: 92%; Dog: 86%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.