HOXA3 Rabbit Polyclonal Antibody
Other products for "HOXA3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HOXA3 antibody: synthetic peptide directed towards the middle region of human HOXA3. Synthetic peptide located within the following region: PPQKRYTAAGAGAGGTPDYDPHAHGLQGNGSYGTPHIQGSPVFVGGSYVE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 46 kDa |
Gene Name | homeobox A3 |
Database Link | |
Background | In vertebrates,The genes encodingThe class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression ofThese proteins is spatially and temporally regulated during embryonic development.This gene is part ofThe A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Three transcript variants encoding two different isoforms have been found forThis gene. [provided by RefSeq, Jul 2008] |
Synonyms | HOX1; HOX1E |
Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Rat: 92%; Rabbit: 92%; Guinea pig: 92%; Dog: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.