SP110 Rabbit Polyclonal Antibody

CAT#: TA341443

Rabbit Polyclonal Anti-SP110 Antibody

Product Images

Host: Rabbit; Target Name: SP110; Sample Tissue: Human MCF7; Antibody Dilution: 1.0 ug/ml; SP110 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

• 

  WB Suggested Anti-SP110 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HT1080 cell lysateThere is BioGPS gene expression data showing that SP110 is expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SP110 antibody: synthetic peptide directed towards the middle region of human SP110. Synthetic peptide located within the following region: DMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVLGFHEANDGGFWTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: SP110 nuclear body protein
• Database Link:
  NP_536349
  Entrez Gene 3431 Human
  UniProt ID Q9HB58
• Background: The nuclear body is a multiprotein complex that may have a role inThe regulation of gene transcription.This gene is a member ofThe SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component.The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested thatThe protein may play a role in ribosome biogenesis and inThe induction of myeloid cell differentiation. Alternative splicing has been observed forThis gene and three transcript variants, encoding distinct isoforms, have been identified. [provided by RefSeq, Jul 2008]
• Synonyms: IFI41; IFI75; IPR1; VODI
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors