BORIS (CTCFL) Rabbit Polyclonal Antibody

CAT#: TA341444

Rabbit Polyclonal Anti-CTCFL Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CTCFL"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CTCFL antibody: synthetic peptide directed towards the N terminal of human CTCFL. Synthetic peptide located within the following region: RSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 76 kDa
Gene Name CCCTC-binding factor like
Background CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation.This gene is a paralog of CTCF and appears to be expressed primarily inThe cytoplasm of spermatocytes, unlike CTCF which is expressed primarily inThe nucleus of somatic cells. CTCF andThe protein encoded byThis gene are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jun 2012]
Synonyms BORIS; CT27; CTCF-T; dJ579F20.2; HMGB1L1
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.