UPF1 Rabbit Polyclonal Antibody

CAT#: TA341559

Rabbit Polyclonal Anti-UPF1 Antibody

Product Images

WB Suggested Anti-UPF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UPF1 antibody: synthetic peptide directed towards the middle region of human UPF1. Synthetic peptide located within the following region: RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 123 kDa
• Gene Name: UPF1, RNA helicase and ATPase
• Database Link:
  NP_002902
  Entrez Gene 5976 Human
  UniProt ID Q92900
• Background: This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream fromThe last exon-exon junction,This triggers NMD to degrade mRNAs containing premature stop codons.This protein is located only inThe cytoplasm. When translation ends, it interacts withThe protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted forThis gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Synonyms: HUPF1; NORF1; pNORF1; RENT1; smg-2
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Zebrafish: 83%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome