DDX5 Rabbit Polyclonal Antibody

CAT#: TA341564

Rabbit Polyclonal Anti-DDX5 Antibody

Product Images

WB Suggested Anti-DDX5 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysateDDX5 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the C terminal of human DDX5. Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: DEAD-box helicase 5
• Database Link:
  NP_004387
  Entrez Gene 1655 Human
  UniProt ID P17844
• Background: DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting withThe simian virus 40 tumor antigen.This gene consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded byThese transcripts have been identified. [provided by RefSeq, Jul 2008]
• Synonyms: G17P1; HLR1; HUMP68; p68
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Spliceosome