Helicase SKI2W (SKIV2L) Rabbit Polyclonal Antibody

CAT#: TA341578

Rabbit Polyclonal Anti-SKIV2L Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SKIV2L"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SKIV2L antibody: synthetic peptide directed towards the middle region of human SKIV2L. Synthetic peptide located within the following region: SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 138 kDa
Gene Name Ski2 like RNA helicase
Background DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box protein, which is a human homologue of yeast SKI2 and may be involved in antiviral activity by blocking translation of poly(A) deficient mRNAs.This gene is located inThe class III region ofThe major histocompatibility complex. [provided by RefSeq, Jul 2008]
Synonyms 170A; DDX13; HLP; SKI2; SKI2W; SKIV2; SKIV2L1; THES2
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 79%
Reference Data
Protein Pathways RNA degradation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.