DDX52 Rabbit Polyclonal Antibody

CAT#: TA341579

Rabbit Polyclonal Anti-DDX52 Antibody

Product Images

WB Suggested Anti-DDX52 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDX52 antibody: synthetic peptide directed towards the N terminal of human DDX52. Synthetic peptide located within the following region: YDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKRE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: DEAD-box helicase 52
• Database Link:
  NP_008941
  Entrez Gene 11056 Human
  UniProt ID Q9Y2R4
• Background: The specific function ofThis protein remains unknown.
• Synonyms: HUSSY19; ROK1
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Mouse: 92%; Rat: 79%