RAD54B Rabbit Polyclonal Antibody

CAT#: TA341583

Rabbit Polyclonal Anti-RAD54B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RAD54B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the N terminal of human RAD54B. Synthetic peptide located within the following region: RRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 103 kDa
Gene Name RAD54 homolog B (S. cerevisiae)
Background The protein encoded byThis gene belongs toThe DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA.This protein binds to double-stranded DNA, and displays ATPase activity inThe presence of DNA.This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations ofThis gene were observed in primary lymphoma and colon cancer. [provided by RefSeq, Jul 2008]
Synonyms RDH54
Note Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rabbit: 85%; Rat: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Homologous recombination

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.