DDX58 Rabbit Polyclonal Antibody

CAT#: TA341588

Rabbit Polyclonal Anti-DDX58 Antibody

Product Images

WB Suggested Anti-DDX58 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDX58 antibody: synthetic peptide directed towards the middle region of human DDX58. Synthetic peptide located within the following region: EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 106 kDa
• Gene Name: DEXD/H-box helicase 58
• Database Link:
  NP_055129
  Entrez Gene 23586 Human
  UniProt ID O95786
• Background: DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure.This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition andThe regulation of immune response. [provided by RefSeq, Jul 2008]
• Synonyms: RIG-I; RIGI; RLR-1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 79%

Reference Data

• Protein Pathways: Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway