beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody

CAT#: TA341637

Rabbit Polyclonal Anti-ADRB1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Other products for "ADRB1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 51 kDa
Gene Name adrenoceptor beta 1
Background The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediateThe physiological effects ofThe hormone epinephrine andThe neurotransmitter norepinephrine. Specific polymorphisms inThis gene have been shown to affectThe resting heart rate and can be involved in heart failure. [provided by RefSeq, Jul 2008]
Synonyms ADRB1R; B1AR; BETA1AR; RHR
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Guinea pig: 93%; Dog: 87%
Reference Data
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Calcium signaling pathway, Dilated cardiomyopathy, Endocytosis, Gap junction, Neuroactive ligand-receptor interaction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.