ANXA8L1 Rabbit Polyclonal Antibody

CAT#: TA341647

Rabbit Polyclonal Anti-ANXA8L2 Antibody

Product Images

WB Suggested Anti-ANXA8L2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: ANXA8L2; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANXA8L2 antibody: synthetic peptide directed towards the middle region of human ANXA8L2. Synthetic peptide located within the following region: VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: annexin A8-like 1
• Database Link:
  NP_001621
  Entrez Gene 244 Entrez Gene 728113 Human
  UniProt ID Q5VT79
• Background: ANXA8L2 is a member ofThe annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins.The protein may function as an anticoagulant that indirectly inhibitsThe thromboplastin-specific complex. Overexpression ofThis gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy ofThis gene is found in close proximity onThe long arm of chromosome 10.This gene encodes a member ofThe annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins.The encoded protein may function as an an anticoagulant that indirectly inhibitsThe thromboplastin-specific complex. Overexpression ofThis gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy ofThis gene is found in close proximity onThe long arm of chromosome 10.
• Synonyms: ANXA8; bA145E20.2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Dog: 86%; Zebrafish: 86%; Guinea pig: 86%