ANXA8L1 Rabbit Polyclonal Antibody
Other products for "ANXA8L2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ANXA8L2 antibody: synthetic peptide directed towards the N terminal of human ANXA8L2. Synthetic peptide located within the following region: PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 37 kDa |
Gene Name | annexin A8-like 1 |
Database Link | |
Background | ANXA8L2 is a member ofThe annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. ANXA8L2 may function as an an anticoagulant that indirectly inhibitsThe thromboplastin-specific complex. Overexpression of ANXA8L2 has been associated with acute myelocytic leukemia.This gene encodes a member ofThe annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins.The encoded protein may function as an an anticoagulant that indirectly inhibitsThe thromboplastin-specific complex. Overexpression ofThis gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy ofThis gene is found in close proximity onThe long arm of chromosome 10. |
Synonyms | ANXA8; bA145E20.2 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.