Germany
Japan
United Kingdom
China
GJA9 Rabbit Polyclonal Antibody
Product Images
Other products for "GJA9"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-GJA9 antibody: synthetic peptide directed towards the middle region of human GJA9. Synthetic peptide located within the following region: IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 59 kDa |
| Gene Name | gap junction protein alpha 9 |
| Database Link | |
| Background | Connexins, such as GJA9, are involved inThe formation of gap junctions, intercellular conduits that directly connectThe cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AL705385.1, AK312811.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025094 [ECO:0000348] ##Evidence-Data-END## |
| Synonyms | CX58; CX59; GJA10 |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 86% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.