TJP1 Rabbit Polyclonal Antibody

CAT#: TA341679

Rabbit Polyclonal Anti-TJP1 Antibody

Product Images

WB Suggested Anti-TJP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Testis

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 187 kDa
• Gene Name: tight junction protein 1
• Database Link:
  NP_783297
  Entrez Gene 7082 Human
  UniProt ID Q07157
• Background: This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions.The encoded protein may be involved in signal transduction at cell-cell junctions. Alternative splicing ofThis gene results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Synonyms: ZO-1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Dog: 92%; Mouse: 87%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Adherens junction, Epithelial cell signaling in Helicobacter pylori infection, Gap junction, Tight junction, Vibrio cholerae infection