MCM7 Rabbit Polyclonal Antibody

CAT#: TA341687

Rabbit Polyclonal Anti-MCM7 Antibody

Product Images

WB Suggested Anti-MCM7 Antibody Titration: 1.25 ug/ml; Positive Control: Daudi cell lysateMCM7 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the middle region of human MCM7. Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: minichromosome maintenance complex component 7
• Database Link:
  NP_005907
  Entrez Gene 4176 Human
  UniProt ID P33993
• Background: The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintenance proteins (MCM) that are essential forThe initiation of eukaryotic genome replication.The hexameric protein complex formed byThe MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other DNA replication related proteins.The MCM complex consisting ofThis protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate withThis protein, and may regulateThe binding ofThis protein withThe tumorsuppressor protein RB1/RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
• Synonyms: CDC47; MCM2; P1.1-MCM3; P1CDC47; P85MCM; PNAS146; PPP1R104
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Pig: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Cell cycle, DNA replication