MCM5 Rabbit Polyclonal Antibody
Other products for "MCM5"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MCM5 antibody: synthetic peptide directed towards the N terminal of human MCM5. Synthetic peptide located within the following region: MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 82 kDa |
Gene Name | minichromosome maintenance complex component 5 |
Database Link | |
Background | The protein encoded byThis gene is structurally very similar toThe CDC46 protein from S. cerevisiae, a protein involved inThe initiation of DNA replication.The encoded protein is a member ofThe MCM family of chromatin-binding proteins and can interact with at least two other members ofThis family.The encoded protein is upregulated inThe transition fromThe G0 to G1/S phase ofThe cell cycle and may actively participate in cell cycle regulation. [provided by RefSeq, Jul 2008] |
Synonyms | CDC46; P1-CDC46 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Rat: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Cell cycle, DNA replication |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.