MCM5 Rabbit Polyclonal Antibody

CAT#: TA341689

Rabbit Polyclonal Anti-MCM5 Antibody

Product Images

WB Suggested Anti-MCM5 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MCM5 antibody: synthetic peptide directed towards the N terminal of human MCM5. Synthetic peptide located within the following region: MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: minichromosome maintenance complex component 5
• Database Link:
  NP_006730
  Entrez Gene 4174 Human
  UniProt ID P33992
• Background: The protein encoded byThis gene is structurally very similar toThe CDC46 protein from S. cerevisiae, a protein involved inThe initiation of DNA replication.The encoded protein is a member ofThe MCM family of chromatin-binding proteins and can interact with at least two other members ofThis family.The encoded protein is upregulated inThe transition fromThe G0 to G1/S phase ofThe cell cycle and may actively participate in cell cycle regulation. [provided by RefSeq, Jul 2008]
• Synonyms: CDC46; P1-CDC46
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Cell cycle, DNA replication