MCM7 Rabbit Polyclonal Antibody

CAT#: TA341695

Rabbit Polyclonal Anti-MCM7 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MCM7"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the middle region of human MCM7. Synthetic peptide located within the following region: LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 81 kDa
Gene Name minichromosome maintenance complex component 7
Background The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintenance proteins (MCM) that are essential forThe initiation of eukaryotic genome replication.The hexameric protein complex formed byThe MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other DNA replication related proteins.The MCM complex consisting ofThis protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate withThis protein, and may regulateThe binding ofThis protein withThe tumorsuppressor protein RB1/RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Synonyms CDC47; MCM2; P1.1-MCM3; P1CDC47; P85MCM; PNAS146; PPP1R104
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%
Reference Data
Protein Families Transcription Factors
Protein Pathways Cell cycle, DNA replication

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.