RUNX2 Rabbit Polyclonal Antibody

CAT#: TA341699

Rabbit Polyclonal Anti-RUNX2 Antibody

Product Images

WB Suggested Anti-RUNX2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the middle region of human RUNX2. Synthetic peptide located within the following region: DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: runt related transcription factor 2
• Database Link:
  NP_001019801
  Entrez Gene 860 Human
  UniProt ID Q13950
• Background: This gene is a member ofThe RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain.This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression.The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations inThis gene have been associated withThe bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result fromThe use of alternate promoters as well as alternate splicing. [provided by RefSeq, Jul 2008]
• Synonyms: AML3; CBF-alpha-1; CBFA1; CCD; CCD1; CLCD; OSF-2; OSF2; PEA2aA; PEBP2aA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors